SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001163003.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001163003.1.81976
Domain Number 1 Region: 177-220
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000377
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001163003.1.81976
Sequence length 229
Comment elfless, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MGDSSDSDSSTEWEQNTRVISLPFSRNRSHLSSRLSYLVGLQMENFRTSNNSGVSQRIHN
TGPTPVLAPSGLRSRLLSGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEYSSDSESSSSS
DSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRIKSDDEESKKSVLPYNCPV
CLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCGVDEPEFHRIFL
Download sequence
Identical sequences Q9VJB0
FBpp0291240 FBpp0291240 FBpp0291241 NP_001163003.1.81976 NP_609860.2.81976 FBpp0291240 FBpp0291241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]