SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001163233.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001163233.1.81976
Domain Number 1 Region: 27-409
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-92
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1168-1242
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000225
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001163233.1.81976
Sequence length 1478
Comment uncharacterized protein Dmel_CG42672, isoform D [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MGSLGHRALLQYIDNNDISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLA
RGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTEL
VRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACR
RGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTA
LCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGHRTVVEALLKKHADVDIQG
KDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLLLDRKA
KVTASDKRGDTCLHIAMRARSKTIVEALLRNPKHSQLLYRANKAGETPYNIDSLHQKTIL
GQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPTLTTPITVGLYAKWGSGKSFLLNKL
RDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYL
LLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAE
ANSASPTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIPIV
LIFELALVTVVTGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVS
LFTSHIRVLKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAFTNQQSRLVGVIDALDSCDT
ERILTLLNAVQTLLSSPNRPFVLLISVDPHVIAKAAEANSRRLFTEGGIGGHDFLRNLVH
LPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEIISSQEK
LRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRR
LMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIVLHHDQFMDSNADESVSLQ
SVYEKLRPKLAYLREAAPLLELDRDERKLDAFLQLHKSDLLVADLRIFLPFTINLDPYLR
KVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELR
SRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPALPKLAPVL
RENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERLPRKQQRQQQQPGALE
APSNVPMIKDVTDALMQPPRESLSRKNSVSHMEKQVTLEEQMICGTLQTLNEEAYEDVAS
SERPSPTELDTPSAGAAMTTPLLGASGSVPAPSGRESILKQQGSVKADKRVSIQQMATSN
NNNNNSTKLTPNVEYVSERQPEVQGAGKRLTTKPPPGPRPASLIITRNDSNSQFQLLRSS
SVDYDDVEAQEHRTTIRTTLLEQQEEEESAPFVFTVRK
Download sequence
Identical sequences E1JGQ4
FBpp0291841 FBpp0291841 NP_001163233.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]