SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001163343.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001163343.1.81976
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily L domain-like 7.14e-27
Family Internalin LRR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001163343.1.81976
Sequence length 362
Comment uncharacterized protein Dmel_CG14995, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFE
DCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAGPNYRSIVLRALPNLK
KLDNVEVTQQEVEDALRGGGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSYPQHSP
PPQQQYQQQQQQQQQQQRGCTTPTKEEYYQSDRPAYPAHYRHSQTDLTEWEEHQQVPQVH
HNPYGSQKQLHQPQRRSAGPEMTPYRNGSARENGGEWDPEDRSRARRPEGRYSDGTSSLS
ASVMNHYSGYHRRPINRLNRIPLSQNSNILSAALCLVKELDYASLEVLEHAVRCRIDELA
NE
Download sequence
Identical sequences E1JIC5
FBpp0291509 FBpp0291509 NP_001163343.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]