SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001163469.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001163469.1.81976
Domain Number 1 Region: 183-491
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.5e-33
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 52-121
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000152
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 136-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001163469.1.81976
Sequence length 555
Comment vermiform, isoform I [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MARWWPILSVVCLCLAVDGLYVKNSFEPAIDQDPSRRYQRKPHGQDKLEGVDVEEVCADR
PADEYFRLETDGDCREVYRCDSAGEDGTWRLAPIRCAGGLAFDVLRQLCDWKSNVKSCDV
LEKPRKAKPILKTDEPICPEGKLSCGDGECLDKELFCNGKSDCKDESDENACSVDEDPNR
APECDPTQCALPDCFCSADGTRIPGGIEPQQVPQMITITFNGAVNVDNIDLYEDIFNGQR
QNPNGCSIKGTFFVSHKYTNYSAVQDLHRRGHEISVFSLTHKDDPNYWTGGSYDDWLAEM
AGSRLIVERFANITDGSIIGMRAPYLRVGGNKQFEMMADQFFVYDASITASLGRVPIWPY
TLYFRMPHKCNGNAHNCPSRSHPVWEMVMNELDRRDDPTFDESLPGCHMVDSCSNVASGD
QFARLLRHNFNRHYNSNRAPLGLHFHASWLKSKKEYRDELIKFIEEMLGRNDVFFVTNLQ
VIQWMQNPTELNSLRDFQEWKEKCDVKGQPYCSLPNACPLTTRELPGETLRLFTCMECPN
NYPWILDPTGDGFSV
Download sequence
Identical sequences E1JI40
FBpp0291538 FBpp0291538 NP_001163469.1.81976 FBpp0291538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]