SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001163645.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001163645.1.81976
Domain Number 1 Region: 437-521
Classification Level Classification E-value
Superfamily Homeodomain-like 7.77e-22
Family SWIRM domain 0.00017
Further Details:      
 
Domain Number 2 Region: 80-133
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000848
Family ZZ domain 0.024
Further Details:      
 
Domain Number 3 Region: 136-187
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000202
Family Homeodomain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001163645.1.81976
Sequence length 527
Comment transcriptional adaptor 2a, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSFMNPVDMVDEDAADLQFPKVEPLGPQVKRFIHAHQNEHTRNSMVLYNPHTLHRYLEEM
EEKTRDQNSSVPSATKDANRCATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNN
HAYIIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYH
DCYFGGIFERLLNLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGD
FDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRY
KIMRQHGLIMPNRTVSWISKYVHAFGSDASCMRFLGFMQICPDPIKFDMLLESLRYYREL
HSQLHKLYDLREHGVRTLSGAKLYARLSKERQQAQRDYSRLKQTDAFDWQQLVQHYESNR
SGDPGPLAINSKLYVMNTRRKASPIEIGDLPGYSKLDDGERKLCSVARLVPQSYLDYKNQ
LVTEQAKLGYLRLADARRLIKIDVNKTRQIYDFLLEHGHISRPPSYG
Download sequence
Identical sequences E1JIP2
FBpp0302533 FBpp0302535 NP_001014637.1.81976 NP_001163645.1.81976 FBpp0099662 FBpp0290771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]