SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001163747.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001163747.1.81976
Domain Number 1 Region: 112-393
Classification Level Classification E-value
Superfamily L domain-like 1.7e-59
Family Internalin LRR domain 0.029
Further Details:      
 
Domain Number 2 Region: 5-169
Classification Level Classification E-value
Superfamily L domain-like 6.46e-30
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 3 Region: 1139-1235
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-25
Family PDZ domain 0.004
Further Details:      
 
Domain Number 4 Region: 716-819
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 5 Region: 1236-1334
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 926-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001163747.1.81976
Sequence length 2490
Comment scribbled, isoform M [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLD
GVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVG
DKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQREVTRLIGHPVFSEDGSVSQISVET
RPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQQQQPIQQVAPTHSYSGNVFATPTAA
QTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRDQIGQGLGFSIAGGKGSPPFKDDCDG
IFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYR
GPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPA
SISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSG
EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRIL
KVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGL
NGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRN
AGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSASCSGGSRQGSRASETGSELSQSQS
VSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPL
PTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAA
DAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGA
PSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEEEESQLQSTPASRDGAEEQQEEVRAK
PTPTKVPKSVSDKKRFFESAMEDQHKPTQKTDKVFSFLSKDEVEKLRQEEERKIATLRRD
KNSRLLDAANDNIDKDAAQQRTKSNSNSSSGDDNDDSDQEEGIARGDSVDNAALGHFDDA
EDMRTAQSLASTMPHAPSKIPKQKLKAKQIESSLPTPTALDPPKPSLLPKPKVKVVIPPA
LQQRLKQQQVQQQQQQHQQSQPEEPSIPEEEYHQQPEPDSPSAAGGSRIPVRTLKAERRA
LTLAARQSGLSVEEYLKRLETQDDKESPASPTTPTGKSRSMINAEKRASWRAARLRSLEQ
GAVEAQDVIKNMRKMTDDLITHESRASEVETCKERIISLELQVPETEDEGKLDDTQPPLE
LEADDFQDDEDDDDDDDDEDDFEDEDEEEDTASIVTVQANNEKLFLRHDSDTYGPSSIES
VASGKVRIKPTPLSLHQTLAKETTIVEVLNPVIGGDGSARTIHVSGGLPFDEDAFEQGAV
AVLRSETFVLPGAAGGGRSELSLNAKMKTVLEELLENERVKLNLQKSLEGEEGEDDDDED
ENGSAYGDARDEEESAYGDAIDDVVDFGSATVTSRAANDKDDVKNGNQQLLEELIKDSNR
NTIIAKLAGQLSDDDEEDDDEEESSDSSDDDSDDSDEEDNAQQQLNVTYVQGAQVIENLN
TLATGGKLQKSQTYTAIKQAEEPKEEDTKLEEDPSAEKPCGADTLAKLQAEQRALAEISK
QLRKSVEDLLSADGETVVETQRTYTLPAPSDSSAVVTVTEVVKKQKKKKSETGEELFNRL
LNAAESERQVFDRQQGETITTTTTTTEAVSSEDNEPSTSVVTTTRTVSNIVTSGIPRPET
SKQNNRSSSSSNSNSSNNNRNKNKRKGKKK
Download sequence
Identical sequences E1JIZ2
NP_001163747.1.81976 FBpp0291313 FBpp0300853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]