SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001165289.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001165289.1.92137
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.05e-87
Family Nuclear receptor ligand-binding domain 0.000000000131
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-27
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001165289.1.92137
Sequence length 441
Comment peroxisome proliferator-activated receptor delta isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences A0A024RCW6 Q03181
9606.ENSP00000310928 ENSP00000310928 ENSP00000353916 ENSP00000310928 ENSP00000353916 gi|284807155|ref|NP_001165289.1| gi|5453940|ref|NP_006229.1| NP_001165289.1.87134 NP_001165289.1.92137 NP_006229.1.87134 NP_006229.1.92137 XP_005249250.1.92137 XP_006715183.1.92137 XP_006715186.1.92137 XP_011513009.1.92137 XP_011513011.1.92137 XP_011513012.1.92137 XP_016866460.1.92137 XP_016866461.1.92137 XP_016866462.1.92137 XP_016866463.1.92137 ENSP00000310928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]