SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001166100.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001166100.1.45394
Domain Number 1 Region: 327-590
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-56
Family Nuclear receptor ligand-binding domain 0.0000000749
Further Details:      
 
Domain Number 2 Region: 254-331
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.58e-28
Family Nuclear receptor 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001166100.1.45394
Sequence length 594
Comment nuclear receptor subfamily 4 group A member 3 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MPCVQAQYGPPPHGSSYSAQSFGYHGDYSADLMATDYTKCELSGGEISAAAATTSLPSFN
VFVEGGFEPKPSCLYQLPPQRPIIKKEEESFPPMAPSDEAIPGSSMYFKQSPPSTPPTPL
HPGPPSSSFLWDEHSLPPVPQPCLIEGPLKSPRFPHFYEQTVPPSTSGYDTAIGLPLRPE
RSPSSSSSSSHVPPNMDTHAHSHVHSHTHSNMYPINMGKPGGLAFRSLGMGHCPPLLGES
LPSPPNRTSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLASKNCPVD
KRRRNRCQYCRFQKCLSVGMVKEVVRTDNLKGRRGRLPSKPKSPLQPEPSPPSPPLSLLN
ALVRAYSQSTPRELDYSQVTDAVEPVGLSESQQIQMFYRVLTGSMEVTRCWAERLPGFSE
LHHDDQNMLIDSAFLELFVLRLANRSLLVDEKFVFCTGLVLHRLQCLRGFGEWLDSIRDF
SAHLQELNLDMPAFSCLCALVLLTEQCPGLKEPKKVEELQSKLICCLRDHLNSINAGGVA
STGKAPPPVGAVLGLRAELRSQRTQGLQRIFYLKLEDLVPPPPLIDRFLDTLPY
Download sequence
Identical sequences F1R8N1
ENSDARP00000072712 ENSDARP00000072712 NP_001166100.1.45394 7955.ENSDARP00000072712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]