SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001167553.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001167553.1.87134
Domain Number 1 Region: 582-1020
Classification Level Classification E-value
Superfamily RNI-like 1.36e-75
Family 28-residue LRR 0.0000195
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-23
Family Pyrin domain, PYD 0.027
Further Details:      
 
Domain Number 3 Region: 184-271,298-357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000376
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001167553.1.87134
Sequence length 1040
Comment NACHT, LRR and PYD domains-containing protein 2 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILT
THCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDV
DEMLERFKTEAQDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLP
GPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELV
FRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLL
NRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAF
ELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQ
LRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFI
HLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGLAN
EKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVM
AQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQ
HMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPAD
AHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWAD
LSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENCHLTEANCKDLAA
VLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDITSDGCCDLTKLLQ
EKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQ
SLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLI
IDTEKHHPWAERPSSHDFMI
Download sequence
Identical sequences NP_001167553.1.87134 NP_001167553.1.92137 gi|291463278|ref|NP_001167553.1| ENSP00000344074 ENSP00000440601 ENSP00000477726 ENSP00000478787 ENSP00000481564 ENSP00000481999 ENSP00000482044 ENSP00000482727 ENSP00000483389 ENSP00000483886 ENSP00000484351 ENSP00000344074 ENSP00000440601 ENSP00000458817 ENSP00000459402 ENSP00000459694 ENSP00000459905 ENSP00000460378 ENSP00000460522 ENSP00000460772 ENSP00000460773 ENSP00000460785 ENSP00000460995 ENSP00000461278 ENSP00000461311 ENSP00000461575 ENSP00000461821 ENSP00000473693 ENSP00000474339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]