SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001171306.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001171306.1.92730
Domain Number 1 Region: 24-266,306-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.47e-55
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-457
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.62e-17
Family L-aminoacid/polyamine oxidase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001171306.1.92730
Sequence length 512
Comment spermine oxidase isoform d [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKVESCESSSHSIDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPPHVIQLGKPVRCIHWDQASAHPRGPEIEPRGEGDHNHDTGEGGQSGENP
QQGRWDEDEPWPVVVECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPCLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMERCDDEAVAEICTEMLRQFTAHAGALLRGGHTPQVLLHHPRCSA
LWPARGRPAHRDVPRPLPAGALKGVLTAKCVP
Download sequence
Identical sequences NP_001171306.1.92730 ENSMUSP00000105818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]