SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001171401.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001171401.1.46622
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 3.49e-47
Family C-type lysozyme 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001171401.1.46622
Sequence length 160
Comment sperm acrosome-associated protein 5 precursor [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MKAWGSVVVTLTMLMAATVDAKIYERCELATKLEKAGLDGFKGYTTGDWLCMAHYESGFD
TSFVNHNPDGSSEYGIFQLNSAWWCDNGVTPTQNLCHMECHELLNRHILDDIMCAQQVVS
SQEGMNAWDSWSQHCSGHDLSEWLKGCHLNVKPDPKRIHS
Download sequence
Identical sequences D5K891
NP_001171401.1.46622 9823.ENSSSCP00000013074 ENSSSCP00000013074 ENSSSCP00000013074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]