SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001171602.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001171602.1.87134
Domain Number 1 Region: 441-695
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 46-288
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-35
Family YWTD domain 0.0000768
Further Details:      
 
Domain Number 3 Region: 359-434,691-742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000204
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 932-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000516
Family EGF-type module 0.0002
Further Details:      
 
Domain Number 6 Region: 702-739,792-868
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000322
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 864-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000489
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001171602.1.87134
Sequence length 1165
Comment pro-epidermal growth factor isoform 3 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCP
RNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECD
CFPGYDLQLDEKSCAASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPV
ENKIYFAHTALKWIERANMDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRS
DLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLI
WPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDW
AMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGT
AWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHM
LVAEIMVSDQDDCAPVGCSMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCP
PASSKCINTEGGYVCRCSEGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAG
RLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACN
CVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKL
LSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAA
DGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKP
HSLLSANPLWQQRALDPPHQMELTQ
Download sequence
Identical sequences ENSP00000424316 gi|296011015|ref|NP_001171602.1| NP_001171602.1.87134 NP_001171602.1.92137 ENSP00000424316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]