SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001177255.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001177255.1.92137
Domain Number 1 Region: 295-334
Classification Level Classification E-value
Superfamily WW domain 0.00000578
Family WW domain 0.0053
Further Details:      
 
Domain Number 2 Region: 584-653
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000554
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 
Weak hits

Sequence:  NP_001177255.1.92137
Domain Number - Region: 503-534
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0444
Family Double-stranded RNA-binding domain (dsRBD) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001177255.1.92137
Sequence length 740
Comment microprocessor complex subunit DGCR8 isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSE
LPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKI
SVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD
KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYE
DDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPT
EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD
NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESER
PILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECARATL
EILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHG
MGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGS
LLRMYGRESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKP
KMSIVASAQPGGEPLCTVDV
Download sequence
Identical sequences A0A2I3T2G0
gi|298358598|ref|NP_001177255.1| ENSP00000372488 ENSP00000384726 NP_001177255.1.87134 NP_001177255.1.92137 ENSP00000372488 ENSP00000384726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]