SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001179199.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001179199.1.76553
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily POZ domain 9.64e-28
Family BTB/POZ domain 0.00086
Further Details:      
 
Domain Number 2 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000202
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001179199.1.76553
Sequence length 612
Comment hypermethylated in cancer 2 protein [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MVSGPLALRWCVWAGRGDMGPDMELPSHSKQLLLQLNQQRTQGFLCDVIVMVENAVFRAH
KNVLAASSVYFKSLVLHDNLISLDTDMVSSAVFQQILDFIYTGRLLPGEPPAEPNFSTLL
TAASYLQLPELAALCRRKLKRAGKPFGSGRGGAGLGRHPRSQRLSTASVIQTRYPGLVDG
RKGAHAPQELSQAKGSDDELFLGGLSQEGAHGLGRPVCPGSGEAGLGGCSTNGAGGSCEQ
ELGLDLSKKSPPLPPATPGPSLTPDDPAQLSDSQEGSPLSTSAPPVANSASYTELGGALS
EPMDLEGADDNPLCLLEGPGGPPPRKSLRHSARKKEWAKKEPAAASPFERRDVAPKGPCP
GEEAEGLGDRVPNGLLAGSAAAGRPFGEPPHACKEEDENGKDGSDDSAQSGSEGGPAGAP
YVYRQEGFEPVPYGDNLYVCIPCAKGFPSSEQLNAHVETHAEEELLLKEEGGAYETGSAG
ADEEAEDLSAPSAALAAGPRPFKCSACEKTYKDAATLRQHEKTHWLARPFPCGICGKMFT
QRGTMTRHMRSHLGLKPFACGECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRN
LISHLRMHTAPS
Download sequence
Identical sequences E1BDC0
ENSBTAP00000007809 ENSBTAP00000007809 NP_001179199.1.59421 NP_001179199.1.76553 XP_019833653.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]