SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001179487.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001179487.1.76553
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Kringle-like 1.37e-19
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-16
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 3 Region: 28-71
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000685
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 4 Region: 118-169
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000742
Family Fibronectin type II module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001179487.1.76553
Sequence length 223
Comment epididymal sperm-binding protein 1 precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MNGWPSYLLGWMAFLLYSYGTTGNKKDSCIFPFTYKGSTYFSCTRANSLSPWCSTRAIYD
GRWKHCLTEDYPRCVFPFIYRGKPHNGCITDGSLFGRQWCSVTSSFDEKQQWKYCETNEY
GGNSFSKPCIFPATYRNHVVSECLEDENNKLWCPTTENMDKDGKWSLCADTRISSLVPGF
PCHFPFNYKNKNYFNCTNKGSKENLLWCATSYNYDRDHTWVYC
Download sequence
Identical sequences E1B9P4
ENSBTAP00000021448 9913.ENSBTAP00000021448 ENSBTAP00000021448 NP_001179487.1.59421 NP_001179487.1.76553 XP_015313653.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]