SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001179956.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001179956.1.76553
Domain Number 1 Region: 196-342
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-43
Family Dual specificity phosphatase-like 0.00000108
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.75e-20
Family Cell cycle control phosphatase, catalytic domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001179956.1.76553
Sequence length 380
Comment dual specificity protein phosphatase 9 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRHRRTEAEAEEWEADSVLGTLLQKLREEGYLAYY
LQGGFSRFQAECPHLCETSLDRRGGPSMAPLPSPVVGLGGLCLGSDCSDVDSEPDRDAMS
CGLDSEGATPPPAGLLPSFPVQILPNLYLGSARDSANVESLAKLGIRYILNVTPNLPNLF
EKNGDFHYKQIPISDHWSQNLSQFFPEAIAFIDEALSQNCGVLVHCLAGVSRSVTVTVAY
LMQKLHLSLNDAYDLVKRKKSNISPNFSFMGQLLDFERSLQLEERRARERGSGGQESAAS
DPPSFFTTPTSDGVFELDAT
Download sequence
Identical sequences F1MEZ2
ENSBTAP00000010955 NP_001179956.1.59421 NP_001179956.1.76553 ENSBTAP00000010955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]