SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001180158.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001180158.1.59421
Domain Number 1 Region: 213-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-110
Family Motor proteins 0.0000000443
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000206
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001180158.1.59421
Sequence length 1368
Comment kinesin-like protein KIF24 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MTSWLYECLYEAELAQYYPHFTALGLQKIDELANVTMKDYSKLGVHDMNDRKRLFQLIKI
IKIMQEEDKAVSSPDSRLQTSNLCVKPQKSRSGPRRQLHFDSPADNKDRTTSNNQFELCD
LSDFSASEQKSNYIKVLEHMLPDDSQYHTQTGILNAAAAHSNIQKAAKISPFSSNHFSPV
QGDCDSSVIQRVSHVSGYNYGIPHSYIRQNTSEKENPWTEMEKIRVCVRKRPLGMREVRR
GEINIITVKDKETLLVHEKKEAVDLTQYILQHVFYFDEIFDEACTNQDIYMKTTHPLIQH
IFNGGNATCFSYGQTGAGKTYTMIGTHQNPGLYALAARDIFRQLEVSQPRRHLFVWISFY
EIYCGQLYDLLNRRKRLFAREDSKHVVQIVGLRELQVDSVELLLEVILKGSKERSTRATG
VNADSSRSHAIIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLL
ALKECIRALDQEHTHTPFRQSKLTQVLKDSFIGNAKTCMIANISPSHVATEHTLNTLRYA
DRVKELKKGIKCCTPANSRNRTSGNSSNASPKRIQSSPVALPGDKYSPKKVKLGLQQPLT
VPSGSMRGKAHPLASHPANIPFASVPKVPGREGGSQGSPPREWVIQTSSSKGTMLSGHVA
IKRAEESAALCSEKNPIGNKTPLGWGSRAPGPGGDLVRGKPPSRCKRVQTVQPVQKQLVS
RGELSFGSAQRLVEYGQGSKVGALSWPASEAWTNNIPVQQEAREEHLRFYHQQFQQPPLL
QQKLQYQPLERFLCRSRPPEGQLQSDILPPFHPHRAESQDGAQVPQAEDPDDSDFSEDSF
SHASCQRTTKQGKSPENSEGSFFLHQREQGPEEQVAERQQSLFFSPDGDEEGVTRSWVYS
RDPAGHRRIALDHGHSPGQVPLDWSGEEDLDSSGPSPREDLAGKSYCAQVDSVYDRERGG
GPAFDLRQEAFRSEVPGQAEGSLPSLEDDGFTCSLSHIAVPGSPDQRDTVSTPLREVSED
SPILETRTMKNSNPFQGDDSKGELGTCSEYASGLMAPLTMSLLESLDDGGAPSWEQPAQA
GTAHGLVAVDTEGPAMGHTVSSGDPEAVLPTSSATEHLWLSSSPPDDKPGGSLPALSPSP
IRQRPPDELPSGEADPGEACQSRGTTLFSRGHRDANAETELDGSQGFLGKPFLTLHPGGP
HAGPTLTPRAGNSDVADQPRAQERKQPTGPSWPELGFSTDPITLSCYKEDIAWLKHRPIP
RSLARPGSPLAASCSPETAGTLRQPALGHAQQVVIQAHQEQLDEMAELGFKEETLMSQLA
PTDFEGFVIQLDEIMVLKSKCIQSLRSQLQLYLACHKPAAGPERTAVS
Download sequence
Identical sequences E1BPB1
ENSBTAP00000027134 ENSBTAP00000027134 NP_001180158.1.59421 NP_001180158.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]