SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001180265.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001180265.2.87134
Domain Number 1 Region: 77-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.12e-52
Family CRAL/TRIO domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 277-388
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.32e-33
Family Supernatant protein factor (SPF), C-terminal domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.57e-19
Family CRAL/TRIO N-terminal domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001180265.2.87134
Sequence length 397
Comment putative SEC14-like protein 6 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MSGQVGDLSPSQEKSLAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHM
EFRKQQDLANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQEL
LRDSFRSCELLLRECELQSQKLGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEA
NYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVE
FGGTMTDPDGNPKCLTKINYGGEVPKSYYLCKQVRLQYEHTRSVGRGSSLQVENEILFPG
CVLRWQFASDGGDIGFGVFLKTKMGERQRAREMTEVLPSQRYNAHMVPEDGILTCLQAGS
YVLRFYNTYSLVHSKRISYTVEVLLPDQTFMEKMEKF
Download sequence
Identical sequences B5MCN3
NP_001180265.2.87134 NP_001180265.2.92137 ENSP00000385695 ENSP00000385695 ENSP00000385695 gi|304766518|ref|NP_001180265.2| 9606.ENSP00000385695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]