SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001180967.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001180967.1.72884
Domain Number 1 Region: 6-256
Classification Level Classification E-value
Superfamily RNI-like 1.26e-41
Family 28-residue LRR 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001180967.1.72884
Sequence length 316
Comment leucine-rich repeat-containing protein 73 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQ
LNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDL
GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNL
DYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENYPTALRSLVLAEN
SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPAAHQRGSSSWMCPSDPSSQMV
LMTSGLGDSLLAETEM
Download sequence
Identical sequences A0A096NIF7 A0A2K5DUR0 A0A2K5TRF7 A0A2K6C613 A0A2K6JUK9 A0A2K6NH47 F7FAD3 H2PJ58 Q5JTD7
ENSP00000361518 9544.ENSMMUP00000030696 9600.ENSPPYP00000018618 9606.ENSP00000361518 ENSMMUP00000030696 ENSP00000361518 ENSMMUP00000030696 ENSPANP00000012755 NP_001012992.1.87134 NP_001012992.1.92137 NP_001180967.1.72884 XP_002816973.1.23681 XP_005552966.1.63531 XP_010368034.1.97406 XP_011752743.1.29376 XP_012304147.1.9421 XP_017733648.1.44346 ENSP00000361518 gi|61175232|ref|NP_001012992.1| ENSPPYP00000018618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]