SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001181555.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001181555.1.72884
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001181555.1.72884
Sequence length 212
Comment ropporin-1B [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVREQSERVA
LCNWAELTPEVLKILHSQVAGRLIVHAEELAQMWKVVNLPADLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEISASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Download sequence
Identical sequences A0A096NEY5 Q4R6C5
ENSMMUP00000010962 NP_001181555.1.72884 NP_001270153.1.63531 ENSMMUP00000010962 9544.ENSMMUP00000010962 ENSPANP00000011950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]