SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001182036.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001182036.1.87134
Domain Number 1 Region: 630-776
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.89e-42
Family Toll/Interleukin receptor TIR domain 0.000000422
Further Details:      
 
Domain Number 2 Region: 32-165,348-566
Classification Level Classification E-value
Superfamily L domain-like 2.55e-41
Family Ngr ectodomain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001182036.1.87134
Sequence length 811
Comment toll-like receptor 10 isoform a [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVL
ATREMYELQTFTELNEESRGSTISLMRTDCL
Download sequence
Identical sequences A0A024R9W4 Q9BXR5
ENSP00000308925 ENSP00000354459 ENSP00000421483 ENSP00000424923 NP_001017388.1.87134 NP_001017388.1.92137 NP_001182035.1.87134 NP_001182035.1.92137 NP_001182036.1.87134 NP_001182036.1.92137 NP_112218.2.87134 NP_112218.2.92137 XP_011512063.1.92137 XP_011512064.1.92137 gi|306140491|ref|NP_001182035.1| gi|306140493|ref|NP_001182036.1| gi|62865618|ref|NP_112218.2| gi|62865621|ref|NP_001017388.1| ENSP00000308925 ENSP00000308925 ENSP00000354459 ENSP00000421483 ENSP00000424923 ENSP00000478206 ENSP00000478985 9606.ENSP00000308925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]