SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001185932.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001185932.1.92730
Domain Number 1 Region: 321-450
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.54e-43
Family Regulator of G-protein signaling, RGS 0.0000224
Further Details:      
 
Domain Number 2 Region: 18-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-32
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 248-310
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.83e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001185932.1.92730
Sequence length 470
Comment regulator of G-protein signaling 7 isoform 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRKRCHERLLHAVLSPRAFV
Download sequence
Identical sequences Q80XD3
10090.ENSMUSP00000083014 ENSMUSP00000083014 NP_001185932.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]