SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001186516.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001186516.1.86415
Domain Number 1 Region: 33-157
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-29
Family Link domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001186516.1.86415
Sequence length 308
Comment lymphatic vessel endothelial hyaluronic acid receptor 1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MTTYFGVTSAVLSVWVMTFMAQNYFITGSTLSPCRITGVGLYLGHKVNFSEASNVCNRLN
LQLASKEQVEKALNHGFETCSSGWIKDGSVAIPRITSNMKCGKGSVGLVNWRPNHAHKFT
VYCFNSSDVQINSCKPDPTTTIIPSSSVPTDLTAYSSSDLTGNTTAVPTAAEPEQTLKNV
KFRIICITETILPTEETTTTMPEESYTYPAAFRNDGVVFGGIPTALLVLAIIFFISSVLL
AVCYIKKYKKCLLFSRKNQKKEVVETTALKDTASNDKILEKETKNNGKMVEEATAKPETT
VKCLEVEV
Download sequence
Identical sequences E1C9I1
NP_001186516.1.86415 XP_015141860.1.86415 ENSGALP00000009036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]