SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001189397.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001189397.1.87134
Domain Number 1 Region: 270-392
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.05e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 134-263
Classification Level Classification E-value
Superfamily Bromodomain 1.18e-17
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 3 Region: 86-151
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000132
Family PHD domain 0.015
Further Details:      
 
Weak hits

Sequence:  NP_001189397.1.87134
Domain Number - Region: 463-528
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0318
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001189397.1.87134
Sequence length 568
Comment zinc finger MYND domain-containing protein 11 isoform g [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFR
VYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADI
ARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKD
RMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFV
EEIKKLATQHKQLISQTKKKQWVNTSLF
Download sequence
Identical sequences A0A2J8RIR3 K7BDM8
NP_001189397.1.87134 NP_001189397.1.92137 ENSP00000452959 gi|321117063|ref|NP_001189397.1| ENSP00000452959 ENSP00000452959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]