SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001190989.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001190989.1.37143
Domain Number 1 Region: 80-347
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.74e-56
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 34-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000149
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001190989.1.37143
Sequence length 348
Comment haptoglobin-related protein precursor [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MSALGGVIAFLLWGRHLFSFYSGDYVMDISDDSCPKPPEIANGYGEHSIRYQCKNYYRLR
TEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAK
MVSRHNLTTGATLINEQWLLTTAKNLFLSHSENAIAKDIAPTLTLYVGEKQLVEIEKVVL
YPNYSQVDIGLIKLKQKVLVNERVMPICLPSKDYAEVGRVGYVSGWGQSDNFKLTDHLKY
VMLPVADQDQCIRHYEGSTVPEKKAPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSA
FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSTQDWVQKTIAEN
Download sequence
Identical sequences NP_001190989.1.37143 ENSPTRP00000054502 ENSPTRP00000058782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]