SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001192143.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001192143.1.92730
Domain Number 1 Region: 242-518
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-77
Family Nuclear receptor ligand-binding domain 0.0000000018
Further Details:      
 
Domain Number 2 Region: 190-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  NP_001192143.1.92730
Domain Number - Region: 163-203
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001192143.1.92730
Sequence length 524
Comment retinoic acid receptor RXR-beta isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MSWATRPPFLPPRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAGEQQALEP
EPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIRPSSPPGPPLTPSAPPPPMPPPPLGSPF
PVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPP
PPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQ
RNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDRILEAELAVEQ
KSDQGVEGPGATGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLR
AGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMR
DMRMDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETYCKQKYPEQQGRFAKL
LLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences Q3TWJ1
10090.ENSMUSP00000036585 ENSMUSP00000036585 ENSMUSP00000036585 NP_001192143.1.92730 ENSMUSP00000036585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]