SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001192241.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001192241.1.92730
Domain Number 1 Region: 910-1193
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-71
Family Protein kinases, catalytic subunit 0.00000622
Further Details:      
 
Domain Number 2 Region: 598-892
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-46
Family Protein kinases, catalytic subunit 0.0000985
Further Details:      
 
Domain Number 3 Region: 470-576,605-631
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000199
Family SH2 domain 0.0059
Further Details:      
 
Domain Number 4 Region: 394-459
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000701
Family Third domain of FERM 0.031
Further Details:      
 
Weak hits

Sequence:  NP_001192241.1.92730
Domain Number - Region: 204-292
Classification Level Classification E-value
Superfamily Second domain of FERM 0.022
Family Second domain of FERM 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001192241.1.92730
Sequence length 1207
Comment non-receptor tyrosine-protein kinase TYK2 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MVGTMPLCGRRAILEDSKADGTEAQPLVPTGCLMVLLHWPGPEGGEPWVTFSQTSLTAEE
VCIHIAHKVGITPPCLNLFALYNAQAKVWLPPNHILDTSQDMNLYFRMRFYFRNWHGMNP
QEPAVYRCGFPGAETSSDRAEQGVQLLDSASFEYLFEQGWYVGNRAKSSHTSFSIHRSTP
QGKHEFMNDVVSLRDLSSEEEIHHFKNESLGMAFLHLCHLALSRGVPLEEMAREISFKNC
IPHSFRQHIRQHNVLTRLRLHRVFRRFLRAFRPGHLSQQVVMVKYLATLERLAPRFGSER
IPVCHLEVLAQPERDPCYIQNSGQTAGDPGPELPSGPPTHEVLVTGTGGIQWHPLQTQES
ERGNSRGNPHGSRSGKKPKAPKAGEHLTESPQEPPWTYFCDFQDISHVVLKERRVHIHLQ
DNKCLLLCLCSQAEALSFVALVDGYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDP
FVQAKLWPEDGLYLIQWSTSHLHRLILTVAHRNPAFSNGPRGLRLRKFPITQQPGAFVLD
GWGRSFASLGDLRLALQGCSLRAGDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNLS
QLSFHRVHQDEITQLSHLGQGTRTNVYEGLLRVGGPDEGKVDNGCPPEPGGTSGQQLRVV
LKVLDPSHHDIALAFYETASLMSQVSHMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWLR
RQRGQVPMTWKMVVAQQLASALSYLEDKNLVHGNVCGRNILLARLGLEEGTNPFIKLSDP
GVGQGALSREERVERIPWTAPECLSGGTSSLGTATDMWGFGATLLEICFDGEAPLQGRGP
SEKERFYTKKHQLPEPSSPELATLTRQCLTYEPAQRPSFRTILRDLTRLQPQNLVGTSAV
NSDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQL
RSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQL
LLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVRED
GDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMT
VLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQGQV
PSVFSVC
Download sequence
Identical sequences E9QJS1
NP_001192241.1.92730 ENSMUSP00000001036 ENSMUSP00000001036 ENSMUSP00000001036 10090.ENSMUSP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]