SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001192499.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001192499.1.76553
Domain Number 1 Region: 2205-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 5.76e-32
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 505-643
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-29
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1469-1517,1595-1709
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1710-1864
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-24
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 961-1118
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-23
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 384-497
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-19
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 7 Region: 2296-2459
Classification Level Classification E-value
Superfamily FAS1 domain 6.28e-17
Family FAS1 domain 0.008
Further Details:      
 
Domain Number 8 Region: 1127-1250
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000693
Family FAS1 domain 0.0063
Further Details:      
 
Domain Number 9 Region: 1541-1578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000804
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001192499.1.76553
Sequence length 2568
Comment stabilin-1 precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAGPRGHLLLCFLALCLAGPSFFGEQKVRSKRCDVKTKFVTHIPCTPCPAIKKRVCPLGW
IRAFPEKISQDCRYEVQLGDSLLSMSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETP
CSGHGTCLDGLDGNGTCVCQENFSGSACQECRDPNRFGPDCQSVCRCVHGVCRHGPRGDG
SCLCFAGYTGARCDQELLACQALNCPRNSQCSEEAPSCSCLPGYTQQGHECRASDPCRPS
PCSPLAQCSVGPGGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSNSTLCLYRKPGQAS
CLCKPGLVSIAHDSSAGCFAHCSAFSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKASQTSMLLRLRVTFAMLDQGCREILSTSGPFTVLAPLVSSRTMNASVAQQLCRQ
HIIAGQHMLEEAGTQAPRRWWTLAGQEITVSFSRFRKYTYKYQDQPQQTFTIHKANYPAA
NGLFHVVTALRLQPPPELPEDPKRTIGQILASNEVFSRFETILENCGLPSFLDGPGPFTV
FAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYNHGQLTVEKLLSKGRVLTMANQIL
AVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPILPKLCNEEQHAVVA
GSCVDCQALNTSTCPPNSVKLDISPEECVYIHDPTGLNVLKKGCAYYCNQTIQKPGCCKG
FFGPDCLQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGDQCQED
CGCVHGLCDNRPGSGGVCQHGTCAPGFSGRFCNESTVSCGSTEQAQQCHPHARCVNQGGV
SRCLCLDGFEGDGFSCTPSDPCSRPDRGGCSENAECVPGVRGAHHCMCHKGWSGDGRVCV
AVDECELDLRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLAT
CRAVGGGQRVCTCPPDYGGDGFSCYGDILKELEANAHFSVFYQWIKGAGITLPADSQVTA
LVPSESAIRRLSTEDQAFWLQPRLLPQLVRAHFLQGALSEEELARLHGQNVSTLNPTVRW
EIHNVSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRRDVLGGQGLLQQLDSVPAFHL
FRELLQRHRLVPQIEAATAYTIFVPTNHSLEAQANSSSLDSDVVRHHVILGEALSTEALG
KGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLQAPGRSLFGLSGVLTVGSSRCLHS
HAEALREKCVNCSRKFRCTQGYQLEDTPRKSCVYRSGYSFSRGCSYTCAKKIQVPDCCPG
FFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGVC
DCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKISGPQCLQKCDPNANCVQDSAAAPVCVCA
AGYSGDGVSCSAVDPCARDHGGCSPHANCTTVAPGQRTCTCLDGYTGDGELCREANSCLI
RHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRACVLLDPCSQNNGGCSPYAVCKSTGDG
QRTCACDAVRTVGDGFTCRARISLELLRDKHASFFSLHLLEYKDLKGDGPFTVFVPHADL
LTNMSQDELARIRANRQLVFRYHVVGCRQLRSQELLEEGYATALSGHPLRFSEREGNIYI
NDFARVVSSDQEAVNGVLHFIDRVLLPPEVLHWEADAAPAPRRNFTAAAETFGYKIFSGL
VTMAGLLPLLQDSSHRPLTMLWPTDSALQALPPDRQVWLYHKDHRDKLAAILRGHVIRNV
EALASDLPNLGPLRTMHGTPISFSCSHARPGALTVGEDAARIVQRHLPFEGGLAYGIDQL
LEPPGLGARCDRFETRPLWLKVCSICGLEPPCPPGSQEQGSPEACWRYFSKFWTSPPLHS
LALRSVWTRPSHWGHPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCNQRG
SCMDGMSGSGECRCHTRFAGTACELCAPGAFGPLCQACNCTSHGRCDEGLGGSGSCFCDE
GWTGPRCEVQLELQPVCAPPCAPQAVCRAGNSCECSLGYEGDGRTCTVVNLCQDGRGGCS
EHANCSQAGTAVTCICWPDYEGDGWSCRARNPCEDGLRGGCSEHADCLNTGPNTRRCVCH
AGYVGDGLQCLLEPEPPVDRCLDRPPPCHADAVCTDLHFQEKRAGVFHLQAPSGPYGLNF
SEAEAACGAQGAVLASLLQLSAAQQLGLHLCLVGWLANGSAAHPVVFPAADCGDGQVGVV
SLGARENLSERWDAYCFRMRDVACRCRDGFVGDGTSVCNGKLLDVLATTANFSIFYGMLL
GYANATPRGLEFLDFLDDERTYKTLFVPVDEAFTDNTTLSGPDLELHASNTTFLSANASQ
GALLPAHSGLSLVIGNLGPGNSSRAPEVPGAVVVSRVIVWDILAFNGIIHTLASPLLAPP
QAWAVVAPEAPPVAAGVGAVVAAGAVLGLVAGALYFRGRSRSAGFGFSAFQAEDAAADDF
SPWQEGTSPPLVSVPNPVFGSHEAFCEPFDDSVLEEDFPDTQRILEVK
Download sequence
Identical sequences E1BNJ1
NP_001192499.1.59421 NP_001192499.1.76553 ENSBTAP00000019663 ENSBTAP00000019663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]