SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001193966.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001193966.1.87134
Domain Number 1 Region: 136-265
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-42
Family ets domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001193966.1.87134
Sequence length 282
Comment transcription factor ETV7 isoform 4 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MHRGARVRDERTRPLHPHQGRLPAPCAQLRSGKRTGFPLSGNPGDVLYELLQYIKTQRRA
LVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGL
ARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRY
EPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQK
LLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
Download sequence
Identical sequences NP_001193966.1.87134 NP_001193966.1.92137 gi|333470739|ref|NP_001193966.1| ENSP00000481885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]