SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001230033.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001230033.1.92730
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-17
Family Ras GEF 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001230033.1.92730
Sequence length 320
Comment predicted gene 6408 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDCMPRRP
RFNYNSPEYVVQMIHYIPAAVQHNDHVCIRIFLAMYPSYASTWKVLDLLMTTYAFFLPDR
IKDQETKRAIFRFLFHWFKKFPKDFYESPDLAVVRQFIDYVRHNVPSADEDTQARELLSV
LEEQEAIGLNPEEDFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAV
LDPSEPKATIELPPSLHQAVPTSDGTLSPVDVTADEATGVAADEAADVAADVSPARQLFV
SYTVQLGTPDFVIPLPEVDI
Download sequence
Identical sequences J3QNG1
ENSMUSP00000136735 PGOMOU00000127457 ENSMUSP00000136735 NP_001230033.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]