SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001230542.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001230542.1.87134
Domain Number 1 Region: 96-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000424
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 8-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000476
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  NP_001230542.1.87134
Domain Number - Region: 126-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00962
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001230542.1.87134
Sequence length 167
Comment LIM domain only protein 3 isoform 4 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEHLKRCGSIYIH
AAHTEIGICVTLEWPLPFVIIDFSQQITIAWLFGVTGNCAACSKLIPAFEMVMRAKDNVY
HLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
Download sequence
Identical sequences A0A2I2ZLY7
ENSGGOP00000023467 ENSP00000442786 ENSP00000379508 ENSP00000442786 NP_001230542.1.87134 NP_001230542.1.92137 ENSGGOP00000023467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]