SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001230592.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001230592.1.46622
Domain Number 1 Region: 118-200
Classification Level Classification E-value
Superfamily DEATH domain 0.000000447
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001230592.1.46622
Sequence length 205
Comment ectodysplasin-A receptor-associated adapter protein [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MASPDDPLRADHLAKEPVEDTDPSTISLNMSDKYPIQDTGLPKAEECDPVALNCPTNSDM
QHQGEENGFPDSTRDPLSDLSKVEPCAKKCTCSSCSLRAPTISDLLNDQDLLDVIRIKLD
PCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRAD
VEKVLRRWVDEEWPKRSREDHPRNV
Download sequence
Identical sequences I3LDN7
ENSSSCP00000022169 ENSSSCP00000022169 NP_001230592.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]