SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001231253.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001231253.1.76553
Domain Number 1 Region: 10-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.7e-41
Family Multidomain sulfurtransferase (rhodanese) 0.00000776
Further Details:      
 
Domain Number 2 Region: 166-283
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.85e-34
Family Multidomain sulfurtransferase (rhodanese) 0.00000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001231253.1.76553
Sequence length 297
Comment 3-mercaptopyruvate sulfurtransferase isoform 2 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MASKQLFRALVSAQWVAEALRAPQAGQPLRLLDASWYLAKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPSAAHFSEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRVF
GHRTVSLLDGGLRNWLRQGLPLSSGKSRPQPAEFHAVLDPAYIKTYEDIKENLESRRFQV
VDARAAGRFRGTEPEPRDGIEPGHIPGTINIPFTDFLTEDGLEKSPEEIRRLFQDKKVDL
SLPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRAQPEDIISEGRGKIH
Download sequence
Identical sequences Q3MHG3
NP_001231253.1.59421 NP_001231253.1.76553 ENSBTAP00000040892 9913.ENSBTAP00000040892 9913.ENSBTAP00000047128 ENSBTAP00000040892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]