SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001232886.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001232886.1.45394
Domain Number 1 Region: 352-486
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-41
Family Synaptotagmin-like (S variant) 0.0000548
Further Details:      
 
Domain Number 2 Region: 218-348
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-40
Family Synaptotagmin-like (S variant) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001232886.1.45394
Sequence length 488
Comment synaptotagmin-7 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MHLNREDEDGKGSLSLSVFLVSVGLTVCVVWLVALCGVCGWCQRKLGMRNKPGVETAGTP
DSVSVSGRGRGENKAINHNDLDRDFWNNNDSCSVQQRWSSYPPKEFLLNMSPYAPYGDPR
LTPKEGKMVVLSLAIGLAEQDDFANLPDLQEAPADTETPPTDKRSNKPGSSPKGQTPDES
HRRTDANSSVSDLANSVTSDMLMLSPGSEEEEHEGPVCEKLGRIQFSVGYSFQDSTLTVK
ILKGQDLPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVV
QRTLYLQVLDYDRFSRNDPIGEVSIPLNKVELVPMQTLWKELKPCSDGSGSRGDLLVSLC
YNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTVVMKRCLNPVFNE
SFPFDVPAHVLRETTIVITVMDKDRLSRNDVIGKIYLSWKSGPAEVKHWKDMMSHPRTAV
AQWHALKA
Download sequence
Identical sequences D4P8S0
ENSDARP00000092005 ENSDARP00000092005 NP_001232886.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]