SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001233302.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001233302.1.37143
Domain Number 1 Region: 225-542
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.39e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000479
Further Details:      
 
Domain Number 2 Region: 93-212
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.81e-24
Family Anticodon-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001233302.1.37143
Sequence length 548
Comment asparagine--tRNA ligase, cytoplasmic [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISK
SQLKNIKKMWHREQMKNESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKISAL
EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVA
VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGE
NMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSS
QLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCD
VVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIP
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIF
NSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP
RFVQRCTP
Download sequence
Identical sequences G2HEW3
ENSPTRP00000017072 9598.ENSPTRP00000017072 NP_001233302.1.37143 XP_003827295.1.60992 ENSPTRP00000017072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]