SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001234934.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001234934.1.92137
Domain Number 1 Region: 333-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.21e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 68-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 154-208,236-250
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000642
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001234934.1.92137
Sequence length 540
Comment aryl hydrocarbon receptor nuclear translocator-like protein 2 isoform 5 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAAEEEAAAGGEVAGGEATAPGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFP
RKRKGSDSDPSQEAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHL
RSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNY
DQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSG
SRRSFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSK
KDNSNFTCLVAIGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQ
ELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNP
WTKELEYIVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIG
TDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSVMVHSWISMPYVTMMTQPWLHL
Download sequence
Identical sequences NP_001234934.1.87134 NP_001234934.1.92137 ENSP00000438545 ENSP00000438545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]