SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001239476.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001239476.1.92730
Domain Number 1 Region: 49-166
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-24
Family SH2 domain 0.00071
Further Details:      
 
Domain Number 2 Region: 402-569
Classification Level Classification E-value
Superfamily Ras GEF 6.54e-22
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001239476.1.92730
Sequence length 702
Comment SH2 domain-containing protein 3C isoform 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTAVGRRCSALEPRRTAAELEAAGDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRS
HAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWHNQALHFKINKVVVKAGES
YTHIRYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLSQG
SSKTASPASPSGSKGSHMKRRSITMTDGLTTDKVTRSDGCPNSTSLPHPRDSIRNCALSM
DQIPDLHSPLSPISESPSSPAYSTVTRVHAPSATPSTSAQPASPVARRSSEPQLCPGNTP
KPPGESDRAPHASPSHTLCKASPSPSLSSYSDPDSGHYCQLQPPVRGSREQAAGETPRKA
RGSGERQKELLENGVSDGEWGKTFTVPVVEATSSFNLATFQSQLIPKENRPLEVALLRKV
KELLSEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLE
RFHTMSIMLAVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALEMAQIS
RLEQTWMTLRQRHTEGAILYEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPFITLLECDSA
PAEGPEPWGSTEHGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEF
QMRLLWGSQGANSSQAWRYEKFDKVLTALSHKLEPAIRSSEL
Download sequence
Identical sequences NP_001239476.1.92730 ENSMUSP00000108868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]