SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001243156.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001243156.1.99540
Domain Number 1 Region: 240-438
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.39e-47
Family Reprolysin-like 0.00028
Further Details:      
 
Domain Number 2 Region: 455-531
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.99e-19
Family Blood coagulation inhibitor (disintegrin) 0.00048
Further Details:      
 
Weak hits

Sequence:  NP_001243156.1.99540
Domain Number - Region: 677-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001243156.1.99540
Sequence length 871
Comment disintegrin and metalloproteinase domain-containing protein 22 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MHIKGGRLASWICCVIGSIHLAHGSTRAGNGWMTGTQRKKENNVLGMEDTVPLRLIFTNE
VDNQTTQGLLSTRVRAGSPQHQDQLTHVARASFQIDAFGSSFILDVELNHDLLSSEYRER
HVTQDGKTVEFKGGEHCYYQGQIRGKAKSFVALSTCYGLHGMFCDGNHTYLIEPGEKYNP
NEDYQFHSVYKSKVLEFPIDELPSEFWPLNDTSPRLSQQTRNQRKKRQTRRYPRNVEDET
KYVELMIVNDHLMYKKHRLSVGHTNSYAKSVVNMADLIYKEQLNTRIVLVAMETWATDNK
FSISENPLLTLKEFMKYRRDFIKDKSDAVHLFSGSQFESSRSGAAYIGGVCSLLKGGGVN
EFGKPDVMAVTLAQSLAHNLGIFSDKKKLLSGECKCEDTWSGCIMGDIGYYLPSKFSVCN
IEEYHEFLNNGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGTIAECAVEGGECCKKCT
LTQDSECSDGLCCSDCKFNPKEMICREAVNDCDIPETCTGNSSQCPANIHKLDGYQCESM
QGLCFGGRCKTRERQCKYIWGEKVSAADKYCYEKLNIEGTEKGNCGRNKETWIQCNKQDV
LCGYLLCTNISSVPRLGELDGDVTTSSVVNQGKLYNCSGGHVKLDEDTDLGYVEDGTPCG
TGMMCLEHRCLPIDSFNFSTCLGSTNKICSGHGVCSNEVKCICDSFWTGDDCSNFLPYDG
IIKPDEGHRDEGVISTNIIIGAIAGTILVLALVLGITAWGYKNYRRERSNGLSHSWSERI
PDTKHVSDVCENGRPRSNSWQGNVSSSRKKLRGKRFRPRSNSTETLSPAKSPSSSTGSIA
SSRKYPYPMPPLPDEERKANKQSARLWETSI
Download sequence
Identical sequences E2ICL8
gi|301079073|gb|ADK56766| NP_001243156.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]