SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001244945.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001244945.2.87134
Domain Number 1 Region: 87-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-54
Family C-terminal domain of adrenodoxin reductase-like 0.0000000046
Further Details:      
 
Domain Number 2 Region: 12-141,325-371
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000129
Family C-terminal domain of adrenodoxin reductase-like 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001244945.2.87134
Sequence length 439
Comment NADPH:adrenodoxin oxidoreductase, mitochondrial isoform 7 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEDKDREHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVE
VGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEP
DLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPL
QVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAE
AARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLP
CGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMT
DSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGT
GKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences A0A0A0MTN9
NP_001244945.2.87134 NP_001244945.2.92137 ENSP00000445432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]