SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001245669.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001245669.1.81976
Domain Number 1 Region: 647-792
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-25
Family Tissue inhibitor of metalloproteinases, TIMP 0.045
Further Details:      
 
Domain Number 2 Region: 445-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 3 Region: 498-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000306
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 4 Region: 561-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  NP_001245669.1.81976
Domain Number - Region: 85-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0822
Family Galactose-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001245669.1.81976
Sequence length 793
Comment Netrin-B, isoform F [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVRATGTRMGLLLPIILALAIGSSAAGISSNDPCYFEGKPRKCLPSFVNAAYGNPVQASS
VCGAQQPERYCELLRDGNAGECRSCEQQRYGPAALTDLNNPSNVTCWRSGAVNVPHDPDS
APPDNVTLTLSLGKKYELTYISLSFCPRSPRPDSLAIFKSSDFGQTWQPFQFYSSQCQKF
YGRPDRAKISKFNEQEARCINSQHDTGGAAQRFAFNTLEGRPSANDLDSSLVLQDWVTAT
DIRVVFHRLELPPQLLKVKNANAFSDEMGGSREEDEDDDADLELDGEQDEYDYNLQDNDS
ADAGYDEYEEPKKHLELDDDHLHLDYASDGESVVKRQGKHKGSAYEKHYQSKLAATTPPQ
QPPKVTPPGKVTPPSTAAPSAAASAVTLPISQHYAVSDFAVGGRCKCNGHASECVATVSS
GSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECERCKPFYF
DRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYC
REGYYRDATKPPNHRKVCKRCDCHPVGSTGKTCNHLSGQCPCKEGVTGLTCNRCARGYQQ
TRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKASPKKLN
LNKFCMEDYAILAKVIGHDRASQDISTEKFSIERQNEIYKYEINIQTIFKRNPMSGTTSS
LLGRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDSEAAPGYLAIGPSSVVLEWKDEWSL
RMKRFQRRARKCS
Download sequence
Identical sequences E1JJP7 Q24568
FBpp0073757 FBpp0291226 FBpp0291227 FBpp0291228 NP_001162753.1.81976 NP_001162754.1.81976 NP_001162755.1.81976 NP_001245668.1.81976 NP_001245669.1.81976 NP_511155.1.81976 FBpp0073757 FBpp0291226 FBpp0291227 FBpp0291228 FBpp0293414 FBpp0293415 FBpp0073757 7227.FBpp0073757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]