SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001246147.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001246147.1.81976
Domain Number 1 Region: 408-486,535-633,710-841
Classification Level Classification E-value
Superfamily TPR-like 6.64e-26
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 
Weak hits

Sequence:  NP_001246147.1.81976
Domain Number - Region: 86-185
Classification Level Classification E-value
Superfamily TPR-like 0.00721
Family Tetratricopeptide repeat (TPR) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001246147.1.81976
Sequence length 851
Comment lethal (2) k14710, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MANKNMRNTTTKVEALIESCRSEGKWHRVIELTDELKTGSPHNECLANFLVGEARLESYL
EENALASDSNFGRAKSGLAEARRFLHLALGESGQKAGIALDAYLLLAKLCFACGEYEQSL
DNFVKAELNTLAEKELTLRSLKILAESYAIKGLCLEQQTTKPSSKFKKAEKDTEMISCFE
RASDLGLLYLQEYDLVSGSSGSSNNSTAGSTLNVNASTVQPSSSSFAISSTIPASGPSGL
EMNRRMGAILETALQRAPIVLIKTEKLQEAVERYRIMLNAIETRATQSLRLTLARQLAEV
LLRGVSGTIYSPPFTGKSGGGTLRGGSSKKLWKPRKYAARQQFNPRNQQEEVILLLLIAE
ALAVRDTVLSQSPEFRQARQHAMGNVTAVYDLLTLATVRWGLVQLLNESFEKALKFSFGE
QHVWRQYGLSLMAAEKHSHALRVLQESMKLTPSDPLPCLLASRLCYESLETVKQGLDYAQ
QALKREVKGLRPSRSQLFVGIGHQQLAIQSNLKSERDACHKLALDALERAVQFDGNDHLA
EYYLSLQYALLGQLAEALVHIRFALALRMEHAPCLHLFALLLTSSRRPREALGVVEDALH
EFPDNLQLLHVKAHLQLHLEDAETALGTVQHMLAVWRDVYEAQLAGEEEKHSDTKSGVHL
AHSSQMSDKDSISRVEQALSEAASSLSSFTQRPGPRRPWMLQIEIWLLLADVYLRIDQPN
EALNCIHEASQIYPLSHQIMFMRGQVHVYLEQWFDAKQCFLNAVAANPNHTEALRALGEA
HLVLGEPRLAEKMLKDAAKLDPSCPKIWFALGKVMEILGDFHASADCFATSLQLEPSCPV
LPFTSIPLVFE
Download sequence
Identical sequences A0A0B4K7H0
NP_001246147.1.81976 FBpp0297109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]