SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001246278.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001246278.1.81976
Domain Number 1 Region: 640-838
Classification Level Classification E-value
Superfamily Sec7 domain 3.92e-66
Family Sec7 domain 0.0000185
Further Details:      
 
Weak hits

Sequence:  NP_001246278.1.81976
Domain Number - Region: 369-531
Classification Level Classification E-value
Superfamily ARM repeat 0.00115
Family Clathrin adaptor core protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001246278.1.81976
Sequence length 1741
Comment gartenzwerg, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MALPGNGIYVVRGEMATLMTAMRRGTRWNATAYVDDENDSLLKLFIDLKHELNRIEDLRQ
IEPQVFLAPFLEVIRTADATGPLTSLALASVNKLLSYGLIDPTSPNLADIVERIADAVTH
ARFMGTDQSSDGVTFMRVIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLR
RSAEKSLKDMVLLFFMRLPQFAEERSDTMLQKRFTIGDAASGATQEKLKRKTVAQAQTAP
RKSSAVEEPPQTPQSANLTVPGHLKAPILATTPASPAGNILDMQGKITQTPTTTASTGED
ETTVPETPVIQVESTESEPLLDGETGEATSTLAEANSSEYINSVGVRFTQQSTDHDVTSL
SPYGLPFIQELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYEGLLELVK
DDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKTP
YEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSKYTLSATNAVYSTH
IISMDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIVIDSGNS
VAAEEKVENIASFINASSHRLRLQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPEK
GIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFT
GLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLN
MDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAEQTGLV
RENYQWKVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKSTETGYQRTL
AGFSKSAAISAHYNLHSDFDALVLTLCKFTTLLSSVEQHEPAPANNETQQAVNFGLNGKA
QAAMRTVFLLVHDYGDCLRESWKHILDLYLQLFRLKLLPKSLIEVEDFCEANGKAMLILE
KPREKQESGLFSSLYSFISSEGQREPTYEEQDFIKLGRKCIKECQLDQMLQESKFVQLES
LQELLKCVLALLKAPQGHKSIGLPYAEDQTVFWMEFLVKIVVHNRDRMIPLWPAVRDQMY
LLLMGSASCGYDYLLNRCIVAVLKLAIYLMRNEELCPIVLQSLKMLLMLKPALLLRISKQ
ISIGIYELLKTSAQNIHSEQDWQIIFNLLECVGAGAVPPNYDDAQLPLPPNGSAKSDGAI
SGEEDATAVPERGYTSDSEITKASAAPAVSSPSAENWILVNNKDSELTTASRPQSPPSLS
APPVNTLVYNCQLLDHAPFALFKCWDSLAFIVRSVAHITPYNFEACVRCIRIFVEACRDG
GIRQRRKLESAAKQKSSKKRSERKPGMASSASSSNLTLLTGDPSDNQINGNAAEQEDLAQ
RYEQLSIQLLDLMYTLYTRTAQIFRWWAEEGCTVPQSAALWSPGWCPLLQGIARLAMDRR
REVRTHAISCLQQRALLVHDLQTLSGTEWCSCFHQVLFPLLNELLPESNAAGQLDAALLE
ESRIRTATIMSKVFLQHLTTLIELGNAFNELWLDILDYIERFMKVGSDTLSEQMQEILKN
MLLVMHSVRVFHNQDGSLQQALWELTWRRIGEFLPNLKEELFHDEADSITPAVSLDYTQI
RFAHSTGTTDYSLSLPLYGYSPKISSISASKCDTLPATQRKKPWAKLRSKLKLLKKVGKK
N
Download sequence
Identical sequences A0A0B4K7N0
NP_001246278.1.81976 FBpp0293612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]