SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001246455.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001246455.1.81976
Domain Number 1 Region: 12-132
Classification Level Classification E-value
Superfamily TPR-like 7.59e-22
Family Tetratricopeptide repeat (TPR) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001246455.1.81976
Sequence length 267
Comment uncharacterized protein Dmel_CG13502, isoform D [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPRKKPKVDTLEEIETNIKLLCDQSNNHMKVRAYEKALFGYNQALELNSTDINALISRSK
CYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPELA
LFRLGVQKTQEAIENTIGSKPGPPGPTASVPKSGKSRKSGEDTPKSQAAGATGTSARTRQ
KPSRADLERRNARKLLGELCVDKEYLEKLLLHPDLVRADTHTESISAYAREAVEFLNKRQ
EFWRQQRPCTALPNHKNLPHDALPKWF
Download sequence
Identical sequences A0A0J9RIK8 D6W4X6
FBpp0300561 NP_001246455.1.81976 XP_016029017.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]