SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001246634.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001246634.1.81976
Domain Number - Region: 3-71
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0345
Family Seryl-tRNA synthetase (SerRS) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001246634.1.81976
Sequence length 163
Comment uncharacterized protein Dmel_CG13707, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTEPISAAVQRRRQLLRSVESLRGRVRQVLKCVINLHIEFLVLESDVAALLDEVREFNDD
HEEMQRLDRMIEALRDYSGPTICHEWPYPLIFKGTIDEAHVAQILNASELDLDTKLVKVS
GGRNCIHVESDVVTAQRRSRLLWFSRRSRGKRAERLKEPNPVV
Download sequence
Identical sequences M9NE27
FBpp0297711 FBpp0297711 NP_001246634.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]