SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001246766.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001246766.1.81976
Domain Number 1 Region: 367-759
Classification Level Classification E-value
Superfamily L domain-like 7.29e-50
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 142-247,278-468
Classification Level Classification E-value
Superfamily RNI-like 3.84e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Domain Number 3 Region: 1108-1248
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.24e-30
Family Toll/Interleukin receptor TIR domain 0.00025
Further Details:      
 
Domain Number 4 Region: 859-1003
Classification Level Classification E-value
Superfamily L domain-like 1.62e-27
Family Ngr ectodomain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001246766.1.81976
Sequence length 1514
Comment Toll-6, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MIYYMLLILPVVLAQDQQHTTESLSTKHHQQQQLSHSNAIMGEAGVSNSQLMQPSTPART
LRPLTAGAGGDPSLYDAPDDCHFMPAAGLDQPEIALTCNLRTVNSEFDTTNFSVIPAEHT
IALHILCNDEIMAKSRLEAQSFAHLVRLQQLSIQYCKLGRLGRQVLDGLEQLRNLTLRTH
NILWPALNFEIEADAFSVTRRLERLDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVN
ELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTL
RRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNN
SISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIF
SDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLD
NNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFK
GLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDG
NELNDINGLFSNMPSLLWLNISDNRLESFDYGHVPSTLQWLDLHKNRLSSLSNRFGLDSE
LKLQTLDVSFNQLQRIGPSSIPNSIELLFLNDNLITTVDPDTFMHKTNLTRVDLYANQIT
TLDIKSLRILPVWEHRALPEFYIGGNPFTCDCNIDWLQKINHITSRQYPRIMDLETIYCK
LLNNRERAYIPLIEAEPKHFLCTYKTHCFAVCHCCEFDACDCEMTCPTNCTCFHDQTWST
NIVECSGAAYSEMPRRVPMDTSELYIDGNNFVELAGHSFLGRKNLAVLYANNSNVAHIYN
TTFSGLKRLLILHLEDNHIISLEGNEFHNLENLRELYLQSNKIASIANGSFQMLRKLEVL
RLDGNRLMHFEVWQLSANPYLVEISLADNQWSCECGYLARFRNYLGQSSEKIIDASRVSC
IYNNATSVLREKNGTKCTLRDGVAHYMHTNEIEGLLPLLLVATCAFVAFFGLIFGLFCYR
HELKIWAHSTNCLMNFCYKSPRFVDQLDKERPNDAYFAYSLQDEHFVNQILAQTLENDIG
YRLCLHYRDVNINAYITDALIEAAESAKQFVLVLSKNFLYNEWSRFEYKSALHELVKRRK
RVVFILYGDLPQRDIDMDMRHYLRTSTCIEWDDKKFWQKLRLALPLPNGRGNNNKRVVSG
CLSGRTPSVNMYATSHEYQAGNGGVIPPPSARYADCGSNNYATINECAAAGGGRGYKPIP
TSASAAAAACKFNTMNQLSKKQQRDLSVAGMAKTLEHQHHHNHQANRRSQHEYAVPSYLP
SAAPAYDSVDYAKQQIRNNANCECVNLGTAKRAAGKNPASGLPSSFSSNFVPPGGASYNC
KKSCSCIGDDELLCSCGGGGGIGVNLLESGTQSSVTMSSSSNNSRQPELTHYESNLSLND
DEDEDHDQQKNLWA
Download sequence
Identical sequences Q9VUN0
FBpp0075367 NP_001246765.1.81976 NP_001246766.1.81976 NP_524081.1.81976 7227.FBpp0075367 FBpp0075367 FBpp0297410 FBpp0297411 FBpp0075367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]