SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001247591.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001247591.1.72884
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.79e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 1136-1269
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000942
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 447-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000209
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 911-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000182
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 594-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 948-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000357
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 783-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 757-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000566
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 1013-1153
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000785
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 325-461
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000036
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 181-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 14 Region: 65-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000273
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 15 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 16 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000572
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1264-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000881
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 18 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000947
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.000000102
Family Notch domain 0.0015
Further Details:      
 
Domain Number 20 Region: 1377-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 21 Region: 108-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 22 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 987-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000573
Family EGF-type module 0.006
Further Details:      
 
Domain Number 24 Region: 28-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000771
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  NP_001247591.1.72884
Domain Number - Region: 1466-1497
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001247591.1.72884
Sequence length 2471
Comment neurogenic locus notch homolog protein 2 precursor [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MPALRPALLWALLALWLCRAAPARALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQHCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGL
FCLHEINECSSHPCLNEGTCVDGLGTYHCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
DKAESRCRCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPNPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFWGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSIPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKNTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPASVHAQHALSFSNLHEMQPLAHGASTVLPS
VSQLLSHHHIVPPSSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
SIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVTGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA
Download sequence
Identical sequences A0A2K6BA81 H9YZ83
9544.ENSMMUP00000024161 NP_001247591.1.72884 XP_011735158.1.29376 ENSMMUP00000016684 ENSMMUP00000024161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]