SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001247720.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001247720.1.72884
Domain Number 1 Region: 178-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-20
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.21e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 296-358
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.4e-17
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 151-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000504
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 355-384
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000113
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001247720.1.72884
Sequence length 386
Comment leupaxin [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKESNLDETSEILSVQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKVSPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCRKPIAGKVIHALGQAWHPEHFVCTH
CKEEIGSSPFFERNGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGHKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL
Download sequence
Identical sequences A0A1D5Q8X5 A0A2K5U3C6
NP_001247720.1.72884 XP_005577849.1.63531 9544.ENSMMUP00000015375 ENSMMUP00000015375 ENSMMUP00000015375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]