SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001247846.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001247846.1.72884
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-44
Family Dual specificity phosphatase-like 0.0000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001247846.1.72884
Sequence length 212
Comment cyclin-dependent kinase inhibitor 3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIQISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTICLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Download sequence
Identical sequences A0A096NV50 A0A2K5WR43 A0A2K6D1W7 F7FIB7 H2NLA0
NP_001247846.1.72884 XP_002824801.1.23681 XP_003267755.1.23891 XP_005561346.1.63531 XP_011739844.1.29376 ENSPANP00000016925 9544.ENSMMUP00000016171 9600.ENSPPYP00000006621 ENSMMUP00000016171 ENSPPYP00000006621 ENSMMUP00000016171 ENSNLEP00000015404 ENSNLEP00000015404 ENSPPYP00000006621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]