SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001250623.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001250623.1.50509
Domain Number 1 Region: 233-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000023
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 8-150
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000112
Family CRAL/TRIO domain 0.008
Further Details:      
 
Domain Number 3 Region: 394-546
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000835
Family Spectrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  NP_001250623.1.50509
Domain Number - Region: 544-652
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0188
Family DNA repair protein MutS, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001250623.1.50509
Sequence length 712
Comment Uncharacterized protein CELE_F55D12.2 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MNWQKQRQHVLDRLAFVPGGTDREGNALLVISTSQVQECSYENLVSLLALLSDTLPPSTL
FTVLLDTRHIQLKQLKFYLRACQQALYKKVRQVLIIQPEKFLDQQKINFDLIVSGYTLKT
VLVSMHKLSKFVDVNQLPEQFGGTLGYDPDSWLSKRIEIKKWQNYLVEVDADSSKHSLDD
DQKLEEFITKLQSTKRIEDEYASNILKKSVRDVKLKEEENSKEGLIKDHTAGVSDFLDWI
EGSGEKWLNSLCQVADNVDEAESLVKQHEELTNKTKEIEEQSHQLAEMATRLMAACPQVA
IVLQKTREQIRDVAEHFAYRVEAQTQFAVSNRTFREKVAEFIKKSDLMLEKVCAEDGASV
KTVEELTSTKKELDDLVNSMNVSFETAMDAGEETVAKARQYSEVLPAEEFVSHIGSSLTY
ISQRQNRHNELASVKRLEQQQHLQLMTTYGDCDQAIKWLGELKETLHKEYSLSDIDEDAV
KNLRNDRQNLDRTAVSTYQYGKQLLSMAKNSERSAMKESSTDERKEKLETAWKELNLAIQ
NNEQRLKVVESFMATHRQMMERVNEIEKSLRERLRVSGKLNSIVLSTERKRLKNDIEELS
NIGNMLSAQINADHATTLQDRQTAVKQISDKINEVMTAQRRMESLIIEEEEAGSSSSGKE
DKHSSRKARPLSKVPEEEGGDVSPVFPRAVRLLETNEGIAPAIRLSKNESYL
Download sequence
Identical sequences Q20833
F55D12.2 6239.F55D12.2 F55D12.2a F55D12.2a NP_001250623.1.50509 F55D12.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]