SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001253423.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001253423.1.72884
Domain Number 1 Region: 41-490
Classification Level Classification E-value
Superfamily Sema domain 1.29e-137
Family Sema domain 0.000000136
Further Details:      
 
Domain Number 2 Region: 837-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.06e-17
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 783-834
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000235
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 595-645
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 486-538
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000174
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 650-701
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 7 Region: 896-941
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000902
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 539-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001253423.1.72884
Sequence length 1074
Comment semaphorin-5A precursor [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MKGTCVIAWLFSSLGLWRLARPEAQGTTQCQRAEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCIFNLSAIAQAFAGPFKYQENSRSAWLPYPNPNPNFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVVVDVVQGREALVHII
YLATDYGTIKKVRAPLNQTASSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLWEHVV
KIPLKRCQFYRTHSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGMWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPSMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPVGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences A0A2K5WPX8 F6TR62
9544.ENSMMUP00000026545 ENSMMUP00000026545 NP_001253423.1.72884 XP_005556642.1.63531 XP_005556643.1.63531 ENSMMUP00000026545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]